-
-
ABOUT US
-
-
SERVICE
SERVICE
Long peptide synthesis
Hefei novabio-chem provides custom peptide synthesis services for peptides up to 150 amino acids in length.
In peptide synthesis, excessively long peptide chains often result in missing residues and difficulties in amino acid condensation. To address these challenges, we have developed three effective solutions to improve reaction success rates:
1. Microwave Synthesis: For amino acids that are difficult to condense during synthesis, we employ microwave synthesis. This method is highly effective and significantly shortens reaction times.
2. Fragment Condensation: When certain peptides are difficult to synthesize using conventional methods, we utilize a fragment condensation approach. This involves condensing several amino acids within a specific peptide segment into a single unit, which is then coupled to the main peptide chain. This method effectively resolves many synthesis challenges.
3. Hydrazide Synthesis: This method involves a chemoselective reaction between the N-terminal Cys peptide (synthesized via solid-phase synthesis) and the C-terminal peptide hydrazide to form an amide bond, thus connecting the peptides. Depending on the position of Cys in the peptide chain, the entire chain is divided into multiple sequences, synthesized separately, and finally condensed via liquid-phase reaction to obtain the target peptide. This significantly improves the purity of the final product and is widely applicable to the synthesis of long-chain peptides containing Cys.
Successful Case Studies:
We have successfully synthesized a long peptide containing 101 amino acids with the sequence:
GHMDIKKEIEAIKKEQEAIKKKIEAIEKELRQLANETTQDLQLFLRDTTELRTFSILNRKDIDFLLQRMKQIEDKIEEIESKQKKIENEIARIKKLIGERY
HPLC Analysis:

MS Analysis:

COOKIES
Our website uses cookies and similar technologies to personalize the advertising shown to you and to help you get the best experience on our website. For more information, see our Privacy & Cookie Policy
COOKIES
Our website uses cookies and similar technologies to personalize the advertising shown to you and to help you get the best experience on our website. For more information, see our Privacy & Cookie Policy
These cookies are necessary for basic functions such as payment. Standard cookies cannot be turned off and do not store any of your information.
These cookies collect information, such as how many people are using our site or which pages are popular, to help us improve the customer experience. Turning these cookies off will mean we can't collect information to improve your experience.
These cookies enable the website to provide enhanced functionality and personalization. They may be set by us or by third-party providers whose services we have added to our pages. If you do not allow these cookies, some or all of these services may not function properly.
These cookies help us understand what you are interested in so that we can show you relevant advertising on other websites. Turning these cookies off will mean we are unable to show you any personalized advertising.
Address: Model B204, B205-1, Hi-tech Capital City High-end Equipment Incubation Base, No. 23, Hangbu Road, Baiyan Science Park, Hi-Tech Zone, Hefei City
Sales Tel: 19856166839; 15705607678; 17354056623
Fax: 0551-62869631
E-mail: sales@bankpeptide.com